PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01512g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 563aa    MW: 63795.8 Da    PI: 6.9019
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01512g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.8e-094815191854
                               HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  Niben101Scf01512g06001.1 481 MFQNflHPYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 519
                               5887779******************************88 PP

2BELL742.4e-24354421371
                      BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                               ++ ++kk +L+ ll+ Vd++Y+q+ +++++vis+F+av++l++  +++++Al++iS  +++L+++i++ 
  Niben101Scf01512g06001.1 354 MDSEAKKKHLVALLQVVDDQYNQCLDEIHMVISAFHAVTELDP-SIHARFALQTISSLYKNLRERISNY 421
                               67899**************************************.9*********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.2E-19288420IPR006563POX domain
PfamPF075265.9E-25294419IPR006563POX domain
PROSITE profilePS5007111.224460523IPR001356Homeobox domain
CDDcd000863.57E-11463524No hitNo description
SMARTSM003895.5E-7463527IPR001356Homeobox domain
SuperFamilySSF466891.63E-15465532IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-26466529IPR009057Homeodomain-like
PfamPF059204.1E-15480519IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MAEPHPIIDE ILLHTASIPI SFPDRIGLNN QNHIMDGQNH IMDGHEIHIP LMLQGEAINS  60
SQAFLSLPNF PRAVDNGAIH NVLPMRNRIK EFSLSTSYPI SNSYSEDLYM EGIPISAVSL  120
ANLLATRNAM PENHENLEAL APLSHPVEGH KTDVLEYPTM LNHSIGSYRN HEFDGVPEIA  180
GTVAGRTGSQ PFQLTRENVN SNTWFSSETS MSSDSPSGSS SRFSNELSLS LTSTQSAVAC  240
GTSIRDQCSD LSCSGVTNHA FSQRRFDSEL TSCNSRNLSL NFGSYKPVHL SQFLTGSRYL  300
RVMQEILSEM AHLSLQNHNW VGYRGNGTEY GANTSFTLSC DDLPDEDRKI IGQMDSEAKK  360
KHLVALLQVV DDQYNQCLDE IHMVISAFHA VTELDPSIHA RFALQTISSL YKNLRERISN  420
YILSMGEHIN RGGERGVEKS FETSFIQKQW ALQQLKRKDH QLWRPQRGLP ERSVSVLRAW  480
MFQNFLHPYP KDAEKQLLAV KSGLTRSQVS NWFINARVRL WKPMIEEMYA EMNRRKIRTG  540
NHEDETNNRR NHKIIDNRLF SMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B9e-15469527563Homeobox protein Meis2
3k2a_A9e-15469527563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016486315.10.0PREDICTED: homeobox protein ATH1-like
SwissprotP487311e-106ATH1_ARATH; Homeobox protein ATH1
TrEMBLK4CLC20.0K4CLC2_SOLLC; Uncharacterized protein
STRINGSolyc08g065420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-105homeobox gene 1